Page Analysis
Related Links:
shotshow.org
nssfmarketplace.com
classicpistol.com
cbshooters.com
web.ics.purdue.edu
odcmp.com
nssf.org
NSSF - National Shooting Sports Foundation
As the firearms industry trade association, NSSF is working to promote, protect and preserve hunting and the shooting sports. Find news and information on the firearms trade association, shooting, hunting, safety and the industry.
As the firearms industry trade association, NSSF is working to promote, protect and preserve hunting and the shooting sports. Find news and information on the firearms trade association, shooting, hunting, safety and the industry.
http://www.nssf.org/
Daily Ad Revenue: ~n/a
Estimated Revenue: ~n/a
Links: 654
Speed: (0.594 seconds) 11% of sites are slower.
Online Since: Feb 21, 1997
Web page information
- Keywords hit in search results about according administration advanced advisor agency
ammunitionanalysisannouncement assistantassociationbackground benefits bettyjane bswann@nssfbusinesscambodiancascadescentercheckcoachcollectioncollegecontactconvicted copyright criminal database dedicated director distribution domain employers exchange federation funds government healthhostedincluding information investmentjoiningkeyword lawsuitlearnlimited located magazine manage marketplace mashups member members ministry misdemeanor national never onlineoregonorganizationsotherspaste pastebinpolicyprivacy process qualified rankingsraptorregister relatedreportresponsiblereview safekeepingsafetysalaamschemesecurity services shooting shootsctpsincesites social sports state suggestions swanntanzaniatermstraditionaluganda updatedvisitwebsite welcome which wikipedia - Search Engine Recommended KeywordsNSSF Logo, NSSF Jobs, NSSF Uganda Website, National Shooting Sports Foundation, Nsssf Tanzania, Working in Oregon Org, WorkSource Oregon Org, State of Oregon Org,
Web Traffic
Web Graph
Web Results
Welcome to NSSF
About NSSF. Background Administration EII Scheme. Exchange Rate. 05/12: 1$ = 4,037 Riel ... manage funds of the scheme, process and pay out benefits to qualified members or ...
The National social Security Fund (NSSF) is a semi-government agency responsible for the collection, safekeeping, responsible investment and distribution of ...
Domain report about nssf.or.tz. According to our information this website is hosted on IP 196.45.144.140 which is located in Dar es Salaam, Tanzania. The ISP ...
Nssf.or.tz analysis mashups. Want to rate or review this site? Check SEO rankings and related sites. Advanced keyword suggestions. Updated on Mar 22, 2012.
To learn more, visit www.nssf.org/join or contact Bettyjane Swann, NSSF director of member services, at 203-426-1320 or bswann@nssf.org.
NSSF Marketplace - The NSSF Marketplace is the database dedicated to the shooting ... NSSF Home NSSF Announcement Privacy Policy Terms of Use Copyright Policy Contact Us Add or ...
They must also have never been convicted of misdemeanor or criminal ... National social Security Fund; Ministry of Health; Cambodian Federation of Employers and Business ...
... shooting organizations in the USA - including but not limited to SCTP, 4H, NRA, NSSF ... Or register as a State Advisor, Head Coach, Assistant Coach or Adult Volunteer.
... college shotgun, rifle or pistol team or club can find resources and grant opportunities at www.nssf.org/college. About NSSF The National Shooting Sports Foundation is the ...
Visit and learn about Nssf.or.tz ... This is a website report about nssf.or.tz. The site is currently hosted in Dar es Salaam, Tanzania on a server with the IP 196 ...
About NSSF. Background Administration EII Scheme. Exchange Rate. 05/12: 1$ = 4,037 Riel ... manage funds of the scheme, process and pay out benefits to qualified members or ...
http://www.nssf.gov.kh/
National Social Security Fund (Uganda) - Wikipedia, the free ...The National social Security Fund (NSSF) is a semi-government agency responsible for the collection, safekeeping, responsible investment and distribution of ...
http://en.wikipedia.org/wiki/National_Social_Security_Fund_(Uganda)
Nssf.or.tz - Pastebin.com - #1 paste tool since 2002!Domain report about nssf.or.tz. According to our information this website is hosted on IP 196.45.144.140 which is located in Dar es Salaam, Tanzania. The ISP ...
http://pastebin.com/d/nssf.or.tz
Website Analysis - Nssf.or.tzNssf.or.tz analysis mashups. Want to rate or review this site? Check SEO rankings and related sites. Advanced keyword suggestions. Updated on Mar 22, 2012.
http://cancanit.com/www/Nssf.or.tz/
From the NSSF | SHOT Business MagazineTo learn more, visit www.nssf.org/join or contact Bettyjane Swann, NSSF director of member services, at 203-426-1320 or bswann@nssf.org.
http://www.shotbusiness.com/Article/NSSF/index.cfm
NSSF MarketplaceNSSF Marketplace - The NSSF Marketplace is the database dedicated to the shooting ... NSSF Home NSSF Announcement Privacy Policy Terms of Use Copyright Policy Contact Us Add or ...
http://nssfmarketplace.com/
www.nssf.gov.khThey must also have never been convicted of misdemeanor or criminal ... National social Security Fund; Ministry of Health; Cambodian Federation of Employers and Business ...
http://www.nssf.gov.kh/_pages/administration.htm
ShootSctp.org - Home... shooting organizations in the USA - including but not limited to SCTP, 4H, NRA, NSSF ... Or register as a State Advisor, Head Coach, Assistant Coach or Adult Volunteer.
http://shootsctp.org/
NSSF - Shooting Sports Retailer Website... college shotgun, rifle or pistol team or club can find resources and grant opportunities at www.nssf.org/college. About NSSF The National Shooting Sports Foundation is the ...
http://www.shootingsportsretailer.com/content/view/2099/4/
Nssf.or.tz - W3Spy.org - Spy Any Website - 0 people onlineVisit and learn about Nssf.or.tz ... This is a website report about nssf.or.tz. The site is currently hosted in Dar es Salaam, Tanzania on a server with the IP 196 ...
http://w3spy.org/site/nssf.or.tz
News Results
NSSF Study – Keep It ‘Fun & Social’ When Introducing Newcomers to Hunting & Shooting
NSSF encourages every individual, organization or company associated with the shooting sports ... For more information, log on to www.nssf.org.
Order or preview them online at www .nssf.org/education/video.cfm. Parents can view home firearms safety tips online at nssf.org/ safety and projectchildsafe.org. » Nationwide boat sales were up last year for the first time since 2006 ...
According to CBD, others joining its lawsuit were the Cascades Raptor Center of Oregon, the Loon Lake Loon Association ... For more information, log on to www.nssf.org. Distributed to you by - AmmoLand.com – The Shooting Sports News source.
According to CBD, others joining its lawsuit were the Cascades Raptor Center of Oregon, the Loon Lake Loon Association ... For more information, log on to www.nssf.org.
NSSF encourages every individual, organization or company associated with the shooting sports ... For more information, log on to www.nssf.org.
AmmoLand.com - Shooting Sports News
FIELD GUIDE: Ducks hunters group to help out DNROrder or preview them online at www .nssf.org/education/video.cfm. Parents can view home firearms safety tips online at nssf.org/ safety and projectchildsafe.org. » Nationwide boat sales were up last year for the first time since 2006 ...
Green Bay Press-Gazette
NSSF to Intervene in Latest Lawsuit Against Traditional AmmunitionAccording to CBD, others joining its lawsuit were the Cascades Raptor Center of Oregon, the Loon Lake Loon Association ... For more information, log on to www.nssf.org. Distributed to you by - AmmoLand.com – The Shooting Sports News source.
AmmoLand.com - Shooting Sports News
Protecting Traditional Ammunition: Senators Tester and Thune Introduce AmendmentAccording to CBD, others joining its lawsuit were the Cascades Raptor Center of Oregon, the Loon Lake Loon Association ... For more information, log on to www.nssf.org.
Right Side News
Website Rank
| Alexa Rank | Compete Rank / Count | Quantcast Rank | Google PageRank |
|---|---|---|---|
| 305,081 | ~ / ~ | ~ |
| Traffic Rank | % of Internet Users | Reach Rank | |
|---|---|---|---|
| Past 1 day: | 1,310,319 | 0.0002% | 1,146,274 |
| Past 7 days: | 225,038 | 0.0008% | 222,410 |
| Past 1 month: | 339,518 | 0.00048% | 331,866 |
| Past 3 months: | 305,081 | 0.00053% | 298,822 |
| PageViews Rank | % of Internet PageViews | Page Views Per User | |
| Past 1 day: | 1,415,737 | 0.000002% | 1 |
| Past 7 days: | 315,251 | 0.000021% | 2.8 |
| Past 1 month: | 446,287 | 0.000013% | 2.7 |
| Past 3 months: | 396,723 | 0.000015% | 2.8 |
Site Disclaimer:
All trademarks are the property of their respective owners. The facts, figures, reviews, records, stats, and other data presented on this page is for suggestion and information purposes only. SiteGlimpse.com is not responsible for any incorrect or incomplete information. SiteGlimpse.com does not take responsibility for any user-reviews of websites inside its resource and reserves the right to keep or remove those. It is highly recommended that you review all the data for accuracy.
All trademarks are the property of their respective owners. The facts, figures, reviews, records, stats, and other data presented on this page is for suggestion and information purposes only. SiteGlimpse.com is not responsible for any incorrect or incomplete information. SiteGlimpse.com does not take responsibility for any user-reviews of websites inside its resource and reserves the right to keep or remove those. It is highly recommended that you review all the data for accuracy.